Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-HSPA8 Antibody

Applications IHC, WB
Reactivities Rat, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL

Goat Polyclonal Antibody against HSPA8 (Isoform 1)

Applications IF, IHC, WB
Reactivities Human, Mouse (Expected from sequence similarity: Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-EKLQGKINDEDKQK, from the internal region of the protein sequence according to NP_006588.1.

Rabbit Polyclonal Anti-HSPA8 Antibody

Applications IHC, WB
Reactivities Rat, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE

Rabbit polyclonal anti-HSPA8(HSC70) antibody, Loading control

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Monkey
Conjugation Unconjugated
Immunogen Recombinant protein of human HSPA8