Primary Antibodies

Jump to Filters
View as table Download
Sonic Hedgehog (SHH) Mouse Monoclonal Antibody [Clone ID: 5H4]
TA336923

USD 550.00

5 Days

Mouse Monoclonal Sonic Hedgehog/Shh Antibody (5H4)

Applications ELISA, FC, ICC/IF, IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated
Sonic Hedgehog (SHH) Rabbit Polyclonal Antibody
TA323715

USD 380.00

In Stock

Anti-SHH Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 448-462 amino acids of Human sonic hedgehog
Sonic Hedgehog (SHH) Rabbit Polyclonal Antibody
TA323716

USD 380.00

In Stock

Anti-SHH Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 448-462 amino acids of Human sonic hedgehog
Sonic Hedgehog (SHH) Rabbit Polyclonal Antibody
TA336926

USD 550.00

5 Days

Rabbit Polyclonal Sonic Hedgehog/Shh Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal portion of the human SHH protein (between residues 1-75) [UniProt Q15465]
Sonic Hedgehog (SHH) Rabbit Polyclonal Antibody
TA334657

USD 539.00

5 Days

Rabbit Polyclonal Anti-SHH Antibody

Applications IHC, WB
Reactivities Human, Mouse, Chicken
Conjugation Unconjugated
Immunogen The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT
Sonic Hedgehog (SHH) (N-term) Rabbit Polyclonal Antibody
AP23351PU-N

USD 560.00

2 Weeks

Sonic Hedgehog (SHH) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence near the N-terminal of human SHH