Primary Antibodies

View as table Download

Mouse Monoclonal Antibody against Survivin (60.11) - Astrocyte Marker

Applications ELISA, FC, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal AKT2 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal c-jun Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit Polyclonal c-Fos Antibody

Applications ELISA, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Mouse Monoclonal Antibody against Survivin (32.1)

Applications ELISA, FC, ICC/IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

Anti-BRAF mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)

Applications ELISA, IHC, IP, WB
Reactivities Human, Dog, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

JNK1 (MAPK8) (318-427) mouse monoclonal antibody, clone 3H2, Purified

Applications ELISA, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

AKT1 (C-term) rabbit polyclonal antibody, Serum

Applications ELISA, IF, IHC, IP, WB
Reactivities Chicken, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide -KLH conjugated corresponding to the C-terminus (460-480) of Human, Rat, Mouse and Chicken AKT proteins conjugated to KLH using maleimide.

Mouse Monoclonal Survivin Antibody (8E2)

Applications Block/Neutralize, ELISA, FC, ICC/IF, IHC
Reactivities Human, Rat
Conjugation Unconjugated

SOS1 mouse monoclonal antibody, clone SOS-1, Aff - Purified

Applications ELISA, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated

ERK2 (MAPK1) mouse monoclonal antibody, clone AT1A4, Purified

Applications ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated

ERK2 (MAPK1) mouse monoclonal antibody, clone AT1A4, Purified

Applications ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated

Mouse monoclonal Akt phospho S473 antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat, Monkey
Conjugation Unconjugated

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

APC2 rabbit polyclonal antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen APC2 antibody was raised against synthetic peptide - KLH conjugated