Primary Antibodies

View as table Download

GABARAP (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1~31 amino acids from the N-terminal region of Human GABARAP

Rabbit Polyclonal GABARAP Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal region of the human GABARAP protein (within residues 50-117). [Swiss-Prot O95166]

GABARAP rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GABARAP

GABARAP rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GABARAP

Rabbit anti-GABARAP Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GABARAP

GABARAP Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GABARAP (NP_009209.1).
Modifications Unmodified

Rabbit Polyclonal GABARAP Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GABARAP antibody was raised against a 19 amino acid peptide near the amino terminus of human GABARAP.

Rabbit Polyclonal GABARAP Antibody

Applications IF, IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal region of the human GABARAP protein (within residues 1-50). [Swiss-Prot O95166]

Rabbit Polyclonal Anti-GABARAP

Applications WB
Reactivities Human, Insect, Cow, Dog, Mouse, Pig, Rabbit, Rat, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for anti-GABARAP antibody: synthetic peptide directed towards the N terminal of human GABARAP. Synthetic peptide located within the following region: IRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL

GABARAP Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide.

GABARAP Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GABARAP (NP_009209.1).
Modifications Unmodified

Rabbit Polyclonal Anti-GABARAP

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABARAP antibody: synthetic peptide directed towards the N terminal of human GABARAP. Synthetic peptide located within the following region: KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLV

GABARAP Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human GABARAP

GABARAP rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated