Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Phospho-PKA alpha/beta/gamma (Thr197) Rabbit polyclonal Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human PKA CAT around the phosphorylation site of Thr197. AA range:166-215 (Phosphorylated) |
Rabbit polyclonal antibody to PRKACA (protein kinase, cAMP-dependent, catalytic, alpha)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 351 of PKA C alpha (Uniprot ID#P17612) |
Rabbit polyclonal PKA alpha/beta CAT (Thr197) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKA a/β CAT around the phosphorylation site of threonine 197 (T-W-TP-L-C). |
| Modifications | Phospho-specific |
PRKACA pThr197 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of threonine 197(R-T-W(p)-T-L) derived from Human PKA α/β CAT (KLH-conjugated) |
Rabbit polyclonal PKA CAT (Ab-197) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PKA CAT around the phosphorylation site of threonine197 (T-W-TP-L-C). |
PRKACA pThr197 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of threonine 197(R-T-W(p)-T-L) derived from Human PKA α/β CAT (KLH-conjugated) |
PRKACA (N-term) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human PKA/C. |
PRKACA (N-term) rabbit polyclonal antibody
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 67-94 amino acids from the N-terminal(K282) region of human PRKACA |
PRKACA rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to the N-terminus of Human PKAα. |
Rabbit polyclonal anti-KAPC A/B antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human KAPC A/B. |
Rabbit Polyclonal Anti-PRKACA Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKACA antibody: synthetic peptide directed towards the N terminal of human PRKACA. Synthetic peptide located within the following region: MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- PRKACA
Reactivities
- Human
Antibody Hosts
- Rabbit
Filter by
Clonalities
Conjugates
Modifications
Assay Types
Families
Pathways
- Apoptosis (8)
- Calcium signaling pathway (8)
- Chemokine signaling pathway (8)
- Dilated cardiomyopathy (8)
- Gap junction (8)
- GnRH signaling pathway (8)
- Hedgehog signaling pathway (8)
- Insulin signaling pathway (8)
- Long-term potentiation (8)
- MAPK signaling pathway (8)
- Melanogenesis (8)
- Olfactory transduction (8)
- Oocyte meiosis (8)
- Prion diseases (8)
- Progesterone-mediated oocyte maturation (8)
- Taste transduction (8)
- Vascular smooth muscle contraction (8)
- Vibrio cholerae infection (8)
- Wnt signaling pathway (8)