Rabbit monoclonal anti-SODM antibody for SISCAPA, clone OTIR4G8
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal anti-SODM antibody for SISCAPA, clone OTIR4G8
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SOD2 Antibody - N-terminal region
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SOD2 antibody: synthetic peptide directed towards the N terminal of human SOD2. Synthetic peptide located within the following region: MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLH |
Rabbit anti-SOD2 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SOD2 |
Anti-SOD2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 25-222 amino acids of human superoxide dismutase 2, mitochondrial |
Rabbit polyclonal SOD (Mn) Antibody
Applications | IHC |
Reactivities | Human, Rat, Mouse, Bovine, Canine, Chicken, Gerbil, Guinea Pig, Pig, Hamster, Rabbit, Monkey, Sheep, Xenopus |
Conjugation | Unconjugated |
Immunogen | Human Mn SOD |
Rabbit Polyclonal Anti-sod2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-sod2 Antibody: A synthesized peptide derived from human sod2 |
SOD2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human SOD2 |
SOD2 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SOD2 |