Primary Antibodies

Jump to Filters
View as table Download
Glycerol kinase (GK) Rabbit Polyclonal Antibody
TA350026

USD 380.00

In Stock

Rabbit Polyclonal Anti-GK Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GK
Glycerol kinase (GK) Rabbit Polyclonal Antibody
TA313926

USD 380.00

In Stock

Rabbit polyclonal anti-GLPK antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human GLPK.
Glycerol kinase (GK) (N-term) Rabbit Polyclonal Antibody
AP51844PU-N

USD 580.00

2 Weeks

Glycerol kinase (GK) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 23-51 amino acids from the N-terminal region of Human Glycerol kinase
Glycerol kinase (GK) Rabbit Polyclonal Antibody
TA312068

USD 380.00

In Stock

Rabbit polyclonal anti-Glycerol Kinase / GLPK3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GLPK3.
Glycerol kinase (GK) Rabbit Polyclonal Antibody
TA333323

USD 539.00

5 Days

Rabbit Polyclonal Anti-GK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GK Antibody: synthetic peptide directed towards the middle region of human GK. Synthetic peptide located within the following region: MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS
Glycerol kinase (GK) Rabbit Polyclonal Antibody
TA347798

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-GK Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GK Antibody: A synthesized peptide derived from human GK