Primary Antibodies

Jump to Filters
View as table Download
ENPP2 (Center) Rabbit Polyclonal Antibody
AP18009PU-N

USD 580.00

2 Weeks

ENPP2 (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human ENPP2
PPAP2A (PLPP1) Rabbit Polyclonal Antibody
TA322830

USD 380.00

4 Weeks

Anti-PPAP2A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A
PPAP2A (PLPP1) Rabbit Polyclonal Antibody
TA322829

USD 380.00

In Stock

Anti-PPAP2A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A
PAFAH2 Rabbit Polyclonal Antibody
TA350832

USD 380.00

In Stock

Rabbit Polyclonal Anti-PAFAH2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PAFAH2
Phospholipase D2 (PLD2) Rabbit Polyclonal Antibody
TA314350

USD 380.00

4 Weeks

Rabbit polyclonal PLD2 (Ab-169) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PLD2.
PPAP2A (PLPP1) Rabbit Polyclonal Antibody
TA346363

USD 485.00

5 Days

Rabbit Polyclonal Anti-PPAP2A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the middle region of human PPAP2A. Synthetic peptide located within the following region: DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL
Phospholipase D2 (PLD2) Rabbit Polyclonal Antibody
TA332122

USD 539.00

5 Days

Rabbit Polyclonal Anti-PLD2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-PLD2 Antibody: synthetic peptide directed towards the middle region of human PLD2. Synthetic peptide located within the following region: DLHYRLTDLGDSSESAASQPPTPRPDSPATPDLSHNQFFWLGKDYSNLIT
Phosphatidic acid phosphatase type 2B (PLPP3) Rabbit Polyclonal Antibody
AP05176PU-N

USD 580.00

5 Days

Phosphatidic acid phosphatase type 2B (PLPP3) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide derived from the phosphatidic acid phosphatase 2B protein
PLA2G12A Rabbit Polyclonal Antibody
TA308641

USD 625.00

5 Days

Rabbit polyclonal antibody to Phospholipase A2 XIIA (phospholipase A2, group XIIA)

Applications WB
Reactivities Human (Predicted: Rat, Bovine, Rhesus Monkey, Mouse)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 22 and 115 of PLA2G12A (Uniprot ID#Q9BZM1)
Phospholipase D2 (PLD2) Rabbit Polyclonal Antibody
TA314349

USD 380.00

4 Weeks

Rabbit polyclonal PLD2 (Tyr169) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PLD2 around the phosphorylation site of tyrosine 169 (E-N-YP-L-N).
Modifications Phospho-specific
PLA2G3 Rabbit Polyclonal Antibody
TA317693

USD 515.00

5 Days

PLA2G3 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bovine, Gorilla, Human, Monkey, Pig, Gibbon (Predicted: Mouse, Horse, Rabbit)
Conjugation Unconjugated
Immunogen PLA2G3 antibody was raised against synthetic 12 amino acid peptide from internal region of human PLA2G3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Elephant, Panda, Pig (100%); Mouse, Horse, Rabbit (92%); Bat, Dog, Opossum (83%).