ACCN4 (ASIC4) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 22-52 amino acids from the N-terminal region of human ACCN4 |
ACCN4 (ASIC4) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 22-52 amino acids from the N-terminal region of human ACCN4 |
Rabbit Polyclonal Anti-ACCN4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACCN4 antibody: synthetic peptide directed towards the middle region of human ACCN4. Synthetic peptide located within the following region: NLTRYGKEISMVRIPNRGSARYLARKYNRNETYIRENFLVLDVFFEALTS |
Rabbit Polyclonal Anti-ACCN4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACCN4 antibody: synthetic peptide directed towards the N terminal of human ACCN4. Synthetic peptide located within the following region: SPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLA |
ASIC4 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ASIC4 |
ASIC4 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ACCN4 |