Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal antibody to alkaline phosphatase (liver/bone/kidney) (alkaline phosphatase, liver/bone/kidney)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Feline, Dog, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 359 of Alkaline Phosphatase (Tissue Non-Specific) (Uniprot ID#P05186) |
Rabbit polyclonal Alkaline Phosphatase (ALPI) Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Alkaline Phosphatase (ALPI) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 274-304 amino acids from the Central region of human Alkaline Phosphatase (ALPI). |
Rabbit polyclonal antibody to Alkaline phosphatase(placental ) (alkaline phosphatase, placental (Regan isozyme))
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 163 and 387 of Placental Alkaline Phosphatase (Uniprot ID#P05187) |
Rabbit polyclonal anti-ALPL antibody
| Applications | WB |
| Reactivities | Mouse, Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ALPL. |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-GGH antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GGH. |
Rabbit anti-DHFR Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DHFR |
Rabbit Polyclonal Anti-GCH1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GCH1 antibody: synthetic peptide directed towards the C terminal of human GCH1. Synthetic peptide located within the following region: LRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLT |
Folylpolyglutamate synthase (FPGS) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human FPGS |
GGH rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SPR (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 232-261aa) of human Sepiapterin reductase / SPR. |
