Primary Antibodies

Jump to Filters
View as table Download
RANTES (CCL5) Rabbit Polyclonal Antibody
AP20618PU-N

USD 445.00

3 Weeks

RANTES (CCL5) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 50-100 of Human RANTES.
MCP1 (CCL2) Rabbit Polyclonal Antibody
TA319701

USD 570.00

2 Weeks

Rabbit Polyclonal CCL2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal CCL2 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human CCL2.
CX3CL1 Rabbit Polyclonal Antibody
TA336789

USD 550.00

5 Days

Rabbit Polyclonal CX3CL1/Fractalkine Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human CX3CL protein (within residues 20-150). [Swiss-Prot P78423]
SDF1 (CXCL12) Rabbit Polyclonal Antibody
TA323612

USD 380.00

4 Weeks

Anti-CXCL12 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 36-50 amino acids of human chemokine (C-X-C motif) ligand 12
SDF1 (CXCL12) Rabbit Polyclonal Antibody
TA323613

USD 380.00

4 Weeks

Anti-CXCL12 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 36-50 amino acids of human chemokine (C-X-C motif) ligand 12
TARC (CCL17) Rabbit Polyclonal Antibody
TA322921

USD 380.00

In Stock

Anti-CCL17 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 73-86 amino acids of human chemokine (C-C motif) ligand 17
TARC (CCL17) Rabbit Polyclonal Antibody
TA322922

USD 380.00

In Stock

Anti-CCL17 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 73-86 amino acids of human chemokine (C-C motif) ligand 17
Macrophage Inflammatory Protein 1 beta (CCL4) Rabbit Polyclonal Antibody
TA319702

USD 570.00

5 Days

Rabbit Polyclonal CCL4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal CCL4 antibody was raised against a 15 amino acid peptide near the center of human CCL4.
TARC (CCL17) Rabbit Polyclonal Antibody
TA319703

USD 570.00

5 Days

Rabbit Polyclonal CCL17 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal CCL17 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human CCL17.
SDF1 (CXCL12) Rabbit Polyclonal Antibody
AP20632PU-N

USD 465.00

3 Weeks

SDF1 (CXCL12) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 50-100 of Human SDF-1.
CX3CL1 Rabbit Polyclonal Antibody
TA322919

USD 380.00

2 Weeks

Anti-CX3CL1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 368-381 amino acids of Human chemokine (C-X3-C motif) ligand 1
SDF1 (CXCL12) Rabbit Polyclonal Antibody
TA347900

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-SDF 1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SDF 1 Antibody: A synthesized peptide derived from human SDF 1
GRO alpha (CXCL1) Rabbit Polyclonal Antibody
TA319046

USD 495.00

In Stock

Rabbit polyclonal anti-CXCL1 (KC) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 78 of mouse KC
GRO alpha (CXCL1) Rabbit Polyclonal Antibody
TA348009

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-GRO alpha

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GRO alpha: A synthesized peptide derived from human GRO alpha
RANTES (CCL5) Rabbit Polyclonal Antibody
TA342306

USD 485.00

5 Days

Rabbit Polyclonal Anti-CCL5 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CCL5 antibody: synthetic peptide directed towards the middle region of mouse CCL5. Synthetic peptide located within the following region: YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN