Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
WNT3A Rabbit monoclonal antibody,clone OTIR4G6
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Wnt-5a Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids 190-230 of human Wnt5A was used as the immunogen for this antibody, GenBank no NP_003383.2. |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Rabbit Polyclonal Anti-WNT1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT1 antibody: synthetic peptide directed towards the middle region of human WNT1. Synthetic peptide located within the following region: FGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTV |
Rabbit polyclonal anti-BMP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BMP2 |
Rabbit polyclonal anti-WNT1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human WNT1. |
Rabbit Polyclonal Anti-WNT7B Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT7B antibody: synthetic peptide directed towards the middle region of human WNT7B. Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM |
WNT1 (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human WNT1 |
WNT6 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Dog, Gorilla, Human, Rabbit, Gibbon, Horse (Predicted: Monkey, Mouse, Rat, Hamster) |
| Conjugation | Unconjugated |
| Immunogen | WNT6 antibody was raised against synthetic 18 amino acid peptide from internal region of human WNT6. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Elephant, Bovine, Dog, Bat, Horse, Rabbit, Opossum (100%); Marmoset, Mouse, Rat, Hamster, Platypus (94%); Turkey, Chicken (83%). |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Mouse
Antibody Hosts
- Rabbit
Families
- Cancer stem cells
Pathways
- Melanogenesis