Primary Antibodies

View as table Download

Anti-SCN11A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 29-41 amino acids of human sodium channel, voltage-gated, type XI, alpha subunit

Anti-SCN10A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 31-45 amino acids of human sodium channel, voltage-gated, type X, alpha subunit

Anti-SCN10A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 31-45 amino acids of human sodium channel, voltage-gated, type X, alpha subunit

Rabbit Polyclonal anti-GRIN2A Antibody

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human GRIN2A

Anti-SCN2A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 30-43 amino acids of human sodium channel, voltage-gated, type II, alpha subunit

Anti-SCN1A/2A/3A/4A/5A/8A/9A/10A/11A/13A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1503-1520 amino acids of human sodium channel, voltage-gated, type XI, alpha subunit

Anti-SCN11A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 29-41 amino acids of human sodium channel, voltage-gated, type XI, alpha subunit

Anti-SCN9A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 25-38 amino acids of human sodium channel, voltage-gated, type IX, alpha subunit

Rabbit Polyclonal Anti-SCN5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCN5A antibody: synthetic peptide directed towards the C terminal of human SCN5A. Synthetic peptide located within the following region: FTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAM

Anti-SCN5A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1860-1874 amino acids of human sodium channel, voltage-gated, type V, alpha subunit

Anti-SCN9A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 25-38 amino acids of human sodium channel, voltage-gated, type IX, alpha subunit

Rabbit Polyclonal Anti-SCN1B Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SCN1B

Anti-SCN2A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 30-43 amino acids of human sodium channel, voltage-gated, type II, alpha subunit

Anti-SCN1A/2A/3A/4A/5A/8A/9A/10A/11A/12A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1503-1520 amino acids of human sodium channel, voltage-gated, type XI, alpha subunit

Anti-SCN5A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1860-1874 amino acids of human sodium channel, voltage-gated, type V, alpha subunit