Primary Antibodies

Jump to Filters
View as table Download
MLH1 Rabbit Polyclonal Antibody
TA590013

USD 482.00

In Stock

Rabbit Polyclonal MLH1 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
MLH1 Rabbit Polyclonal Antibody
TA335134

USD 539.00

5 Days

Rabbit polyclonal Anti-MLH1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MLH1 antibody: synthetic peptide directed towards the N terminal of human MLH1. Synthetic peptide located within the following region: MIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSK
MLH1 Rabbit Polyclonal Antibody
TA311753

USD 380.00

In Stock

Rabbit polyclonal anti-MLH1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MLH1.