Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-ESRRG Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ESRRG

Rabbit Polyclonal Anti-ESRRG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ESRRG antibody: synthetic peptide directed towards the N terminal of human ESRRG. Synthetic peptide located within the following region: TMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYML

Rabbit Polyclonal Anti-ESRRG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ESRRG antibody: synthetic peptide directed towards the N terminal of human ESRRG. Synthetic peptide located within the following region: DRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQN

Rabbit polyclonal ESRRG Antibody (Center)

Applications WB
Reactivities Human (Predicted: Mouse, Rat)
Conjugation Unconjugated
Immunogen This ESRRG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 189-221 amino acids from the Central region of human ESRRG.