Rabbit Polyclonal Anti-ESRRG Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ESRRG |
Rabbit Polyclonal Anti-ESRRG Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ESRRG |
Rabbit Polyclonal Anti-ESRRG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ESRRG antibody: synthetic peptide directed towards the N terminal of human ESRRG. Synthetic peptide located within the following region: TMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYML |
Rabbit Polyclonal Anti-ESRRG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ESRRG antibody: synthetic peptide directed towards the N terminal of human ESRRG. Synthetic peptide located within the following region: DRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQN |
Rabbit polyclonal ESRRG Antibody (Center)
Applications | WB |
Reactivities | Human (Predicted: Mouse, Rat) |
Conjugation | Unconjugated |
Immunogen | This ESRRG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 189-221 amino acids from the Central region of human ESRRG. |