Primary Antibodies

Jump to Filters
View as table Download
PSME2 (C-term) Rabbit Polyclonal Antibody
AP17686PU-N

USD 580.00

2 Weeks

PSME2 (C-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human PSME2
PSME2 (Center) Rabbit Polyclonal Antibody
AP17685PU-N

USD 580.00

2 Weeks

PSME2 (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human PSME2
PSME2 Rabbit Polyclonal Antibody
TA332767

USD 450.00

3 Weeks

Rabbit anti-PSME2 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PSME2
PSME2 Rabbit Polyclonal Antibody
TA342178

USD 539.00

5 Days

Rabbit polyclonal Anti-PSME2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSME2 antibody: synthetic peptide directed towards the middle region of human PSME2. Synthetic peptide located within the following region: QEKVLERVNAVKTKVEAFQTTISKYFSERGDAVAKASKETHVMDYRALVH
PSME2 Rabbit Polyclonal Antibody
TA342179

USD 539.00

5 Days

Rabbit polyclonal Anti-PSME2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSME2 antibody: synthetic peptide directed towards the middle region of human PSME2. Synthetic peptide located within the following region: SKETHVMDYRALVHERDEAAYGELRAMVLDLRAFYAELYHIISSNLEKIV