Primary Antibodies

Jump to Filters
View as table Download
MRP4 (ABCC4) Rabbit Polyclonal Antibody
TA327332

USD 365.00

3 Weeks

ABCC4 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ABCC4
VDAC1 Rabbit Polyclonal Antibody
TA308959

USD 625.00

In Stock

Rabbit polyclonal anti-VDAC1/Porin antibody, Loading control

Applications IHC, WB
Reactivities Human, Mouse, Monkey, Dog
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 211 of VDAC1 (Uniprot ID#P21796)
CHRFAM7A Rabbit Polyclonal Antibody
TA321939

USD 380.00

4 Weeks

Anti-CHRFAM7A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 32-46 amino acids of human CHRNA7 (cholinergic receptor, nicotinic, alpha 7, exons 5-10) and FAM7A (family with sequence similarity 7A, exons A-E) fusion
Kv beta 2 (KCNAB2) Rabbit Polyclonal Antibody
TA331456

USD 539.00

5 Days

Rabbit polyclonal Anti-KCNAB2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNAB2 antibody: synthetic peptide directed towards the middle region of human KCNAB2. Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV
Aquaporin 1 (AQP1) (C-term) Rabbit Polyclonal Antibody
AP23362PU-N

USD 560.00

2 Weeks

Aquaporin 1 (AQP1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a sequence mapping near the C-terminal of human AQP1