Primary Antibodies

View as table Download

Anti-ARF6 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 162-175 amino acids of Human ADP-ribosylation factor 6

Anti-ARF6 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 162-175 amino acids of Human ADP-ribosylation factor 6

Rabbit Polyclonal Anti-ARF6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ARF6

Rabbit Polyclonal ARF6 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ARF6 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human ARF6.

ARF6 Antibody - C-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of human ARF6

Rabbit Polyclonal Anti-ARF6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARF6 antibody: synthetic peptide directed towards the middle region of human ARF6. Synthetic peptide located within the following region: REMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSG