Primary Antibodies

Jump to Filters
View as table Download
CK1 epsilon (CSNK1E) Rabbit Polyclonal Antibody
TA349647

USD 380.00

In Stock

Rabbit Polyclonal Anti-CSNK1E Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CSNK1E
Casein Kinase 1 delta (CSNK1D) Rabbit Polyclonal Antibody
TA349833

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-CSNK1D Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CSNK1D
CK1 epsilon (CSNK1E) Rabbit Polyclonal Antibody
TA312479

USD 380.00

In Stock

Rabbit polyclonal anti-CKI-e antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CKI-e.
SHARP1 (BHLHE41) Rabbit Polyclonal Antibody
TA336739

USD 550.00

5 Days

Rabbit Polyclonal DEC2/SHARP1 Antibody

Applications IHC, Simple Western, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human PAI1/Serpine 1 protein (between residues 1-75) [UniProt Q9C0J9]
NR1D1 Rabbit Polyclonal Antibody
TA350237

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-NR1D1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NR1D1
CLOCK Rabbit Polyclonal Antibody
TA312928

USD 380.00

In Stock

Rabbit polyclonal anti-Clock antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human Clock.
TPTEP2-CSNK1E Rabbit Polyclonal Antibody
AP20419PU-N

USD 465.00

3 Weeks

TPTEP2-CSNK1E rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 250-350 of Human Casein Kinase Iε.
SHARP1 (BHLHE41) Rabbit Polyclonal Antibody
AP20458PU-N

USD 445.00

3 Weeks

SHARP1 (BHLHE41) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide around Lys31 of Human BHLHE41 / BHLHB3
CRY2 (C-term) Rabbit Polyclonal Antibody
AP13098PU-N

USD 580.00

2 Weeks

CRY2 (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human CRY2.
BMAL1 (ARNTL) Rabbit Polyclonal Antibody
TA329741

USD 485.00

5 Days

Rabbit Polyclonal Anti-ARNTL Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ARNTL antibody: synthetic peptide directed towards the N terminal of human ARNTL. Synthetic peptide located within the following region: TDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSF