Germany
Japan
United Kingdom
China
Rabbit Polyclonal Antibody against Survivin - Astrocyte Marker
| Applications | ChIP, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Feline, Dog |
| Conjugation | Unconjugated |
| Immunogen | Full-length recombinant human survivin. |
Primary Antibodies
View as table Download
Rabbit Polyclonal c-Myc Antibody
| Applications | ChIP, ELISA, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106] |
AKT1 (C-term) rabbit polyclonal antibody, Serum
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Chicken, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide -KLH conjugated corresponding to the C-terminus (460-480) of Human, Rat, Mouse and Chicken AKT proteins conjugated to KLH using maleimide. |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
c-Myc (MYC) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Conjugation | Unconjugated |
| Immunogen | This antibody was purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. |
Rabbit Polyclonal JNK1 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | C. elegans (Does not react with: Human, Mammalian, Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | A recombinant protein made to the C-terminus (residues 228-451) of the C. elegans JNK1 alpha protein. |
c-Myc (MYC) rabbit polyclonal antibody, Biotin
| Applications | ELISA, IHC, WB |
| Conjugation | Biotin |
| Immunogen | Purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. The sequence corresponds to aa 410-419 of human c-Myc. |
Active filters
Applications
- ELISA
Antibody Hosts
- Rabbit
Pathways
- Colorectal cancer
Filter by
Category
Target Symbol
Reactivities
Isotypes
Clonalities
Conjugates
Assay Types
Families
- Druggable Genome (33)
- ES Cell Differentiation/IPS (20)
- Protein Kinase (17)
- Stem cell relevant signaling - JAK/STAT signaling pathway (15)
- Transmembrane (15)
- Adult stem cells (11)
- Cancer stem cells (11)
- Secreted Protein (11)
- Stem cell - Pluripotency (8)
- Transcription Factors (8)
- Embryonic stem cells (4)
- Induced pluripotent stem cells (4)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (4)
- Stem cell relevant signaling - Wnt Signaling pathway (4)
- Protease (1)