Galectin 3 (LGALS3) (NM_002306) Human Recombinant Protein

CAT#: TP720583

Reviews ()
Write a review

Purified recombinant protein of Human lectin, galactoside-binding, soluble, 3 (LGALS3), transcript variant 1


Product Datasheet for 'TP720583'


  View other "LGALS3" proteins (5)

USD 300.00


Availability*
2 Weeks

Size
    • 50 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human lectin, galactoside-binding, soluble, 3 (LGALS3), transcript variant 1
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Tag Tag Free
Predicted MW 26 kDa
Concentration Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.4
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_002297
Locus ID 3958
Refseq Size 1017
Cytogenetics 14q22.3
Refseq ORF 750
Synonyms CBP35; GAL3; GALBP; GALIG; L31; LGALS2; MAC2
Summary This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]
Protein Families Secreted Protein

Documents

Other Versions

Other products for "LGALS3"
Frequently bought together (1)
LGALS3 mouse monoclonal antibody, clone OTI1G8 (formerly 1G8)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101