Spry2 (NM_011897) Mouse Recombinant Protein

CAT#: TP526937

Purified recombinant protein of Mouse sprouty RTK signaling antagonist 2 (Spry2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR226937 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEARAQSGNGSQPLLQTAHDSGRQRGEPDPRDALTQQVHVLSLDQIRAIRNTNEYTEGPTVVPRPGLKPA
  PRPSTQHKHERLHGLPEHRQPPRLQPSQVHSSRAPLSRSISTVSSGSRSSTRTSTSSSSSEQRLLGPSFS
  HGPAAADGIIRVQPKSELKPGDVKPLSKDDLGLHAYRCEDCGKCKCKECTYPRPLPSDWICDKQCLCSAQ
  NVIDYGTCVCCVKGLFYHCSNDDEDNCADNPCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQ
  GCYDRVNRPGCRCKNSNTVCCKVPTVPPRNFEKPT
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 34.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_036027
• Locus ID: 24064
• UniProt ID: Q9QXV8, B2RS85
• Cytogenetics: 14 56.16 cM
• Refseq Size: 2103
• Refseq ORF: 948
• Synonyms: sprouty2
• Summary: May function as an antagonist of fibroblast growth factor (FGF) pathways and may negatively modulate respiratory organogenesis.[UniProtKB/Swiss-Prot Function]