Ntrk1 (NM_001033124) Mouse Recombinant Protein

CAT#: TP526042

Purified recombinant protein of Mouse neurotrophic tyrosine kinase, receptor, type 1 (Ntrk1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR226042 representing NM_001033124
  Red=Cloning site Green=Tags(s)
  
  MLRGQRLGQLGWHRPAAGLGSLMTSLMLACASAASCREVCCPVGPSGLRCTRAGSLDTLRGLRGAGNLTE
  LYVENQQHLQRLEFEDLQGLGELRSLTIVKSGLRFVAPDAFRFTPRLSHLNLSSNALESLSWKTVQGLSL
  QDLTLSGNPLHCSCALFWLQRWEQEGLCGVHTQTLHDSGPGDQFLPLGHNTSCGVPTVKIQMPNDSVEVG
  DDVFLQCQVEGLALQQADWILTELEGAATVKKFGDLPSLGLILVNVTSDLNKKNVTCWAENDVGRAEVSV
  QVSVSFPASVHLGLAVEQHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTQFLESALTNETMRHGCLR
  LNQPTHVNNGNYTLLAANPYGQAAASVMAAFMDNPFEFNPEDPIPVSFSPVDGNSTSRDPVEKKDETPFG
  VSVAVGLAVSAALFLSALLLVLNKCGQRSKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQ
  GHIMENPQYFSDTCVHHIKRQDIILKWELGEGAFGKVFLAECYNLLNDQDKMLVAVKALKEASENARQDF
  QREAELLTMLQHQHIVRFFGVCTEGGPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQL
  LAVASQVAAGMVYLASLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPE
  SILYRKFSTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIECITQGRELERPRACPPDVYAIMRGCWQRE
  PQQRLSMKDVHARLQALAQAPPSYLDVLG
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 88.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001028296
• Locus ID: 18211
• UniProt ID: Q3UFB7
• Cytogenetics: 3 38.62 cM
• Refseq Size: 2606
• Refseq ORF: 2397
• Synonyms: C80751; Tkr; trk; TrkA
• Summary: Receptor tyrosine kinase involved in the development and the maturation of the central and peripheral nervous systems through regulation of proliferation, differentiation and survival of sympathetic and nervous neurons. High affinity receptor for NGF which is its primary ligand, it can also bind and be activated by NTF3/neurotrophin-3. However, NTF3 only supports axonal extension through NTRK1 but has no effect on neuron survival. Upon dimeric NGF ligand-binding, undergoes homodimerization, autophosphorylation and activation. Recruits, phosphorylates and/or activates several downstream effectors including SHC1, FRS2, SH2B1, SH2B2 and PLCG1 that regulate distinct overlapping signaling cascades driving cell survival and differentiation. Through SHC1 and FRS2 activates a GRB2-Ras-MAPK cascade that regulates cell differentiation and survival. Through PLCG1 controls NF-Kappa-B activation and the transcription of genes involved in cell survival. Through SHC1 and SH2B1 controls a Ras-PI3 kinase-AKT1 signaling cascade that is also regulating survival. In absence of ligand and activation, may promote cell death, making the survival of neurons dependent on trophic factors.[UniProtKB/Swiss-Prot Function]