Amh (NM_007445) Mouse Recombinant Protein

CAT#: TP525495

Purified recombinant protein of Mouse anti-Mullerian hormone (Amh), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR225495 representing NM_007445
  Red=Cloning site Green=Tags(s)
  
  MQGPHLSPLVLLLATMGAVLQPEAVENLATNTRGLIFLEDELWPPSSPPEPLCLVTVRGEGNTSRASLRV
  VGGLNSYEYAFLEAVQESRWGPQDLATFGVCSTDSQATLPALQRLGAWLGETGEQQLLVLHLAEVIWEPE
  LLLKFQEPPPGGASRWEQALLVLYPGPGPQVTVTGTGLRGTQNLCPTRDTRYLVLTVDFPAGAWSGSGLI
  LTLQPSREGATLSIDQLQAFLFGSDSRCFTRMTPTLVVLPPAEPSPQPAHGQLDTMPFPQPGLSLEPEAL
  PHSADPFLETLTRLVRALRGPLTQASNTQLALDPGALASFPQGLVNLSDPAALGRLLDWEEPLLLLLSPA
  AATEREPMPLHGPASAPWAAGLQRRVAVELQAAASELRDLPGLPPTAPPLLARLLALCPNDSRSSGDPLR
  ALLLLKALQGLRAEWHGREGRGRTGRSAGTGTDGPCALRELSVDLRAERSVLIPETYQANNCQGACAWPQ
  SDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISAHHVPNMVATECGCR
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 59.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_031471
• Locus ID: 11705
• UniProt ID: Q5EC55
• Cytogenetics: 10 39.72 cM
• Refseq Size: 1665
• Refseq ORF: 1662
• Synonyms: M; MIS
• Summary: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate N- and C-terminal cleavage products that homodimerize and associate to form a biologically active noncovalent complex. This complex binds to the anti-Mullerian hormone receptor type 2 and causes the regression of Mullerian ducts in the male embryo that would otherwise differentiate into the uterus and fallopian tubes. This protein also plays a role in Leydig cell differentiation and function and follicular development in adult females. Homozygous knockout male mice develop female reproductive organs and are often sterile, while homozygous knockout female mice exhibit premature depletion of primordial follicles. [provided by RefSeq, Jul 2016]