Amh (NM_007445) Mouse Recombinant Protein
CAT#: TP525495
Purified recombinant protein of Mouse anti-Mullerian hormone (Amh), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Amh"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR225495 representing NM_007445
Red=Cloning site Green=Tags(s) MQGPHLSPLVLLLATMGAVLQPEAVENLATNTRGLIFLEDELWPPSSPPEPLCLVTVRGEGNTSRASLRV VGGLNSYEYAFLEAVQESRWGPQDLATFGVCSTDSQATLPALQRLGAWLGETGEQQLLVLHLAEVIWEPE LLLKFQEPPPGGASRWEQALLVLYPGPGPQVTVTGTGLRGTQNLCPTRDTRYLVLTVDFPAGAWSGSGLI LTLQPSREGATLSIDQLQAFLFGSDSRCFTRMTPTLVVLPPAEPSPQPAHGQLDTMPFPQPGLSLEPEAL PHSADPFLETLTRLVRALRGPLTQASNTQLALDPGALASFPQGLVNLSDPAALGRLLDWEEPLLLLLSPA AATEREPMPLHGPASAPWAAGLQRRVAVELQAAASELRDLPGLPPTAPPLLARLLALCPNDSRSSGDPLR ALLLLKALQGLRAEWHGREGRGRTGRSAGTGTDGPCALRELSVDLRAERSVLIPETYQANNCQGACAWPQ SDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISAHHVPNMVATECGCR myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 59.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_031471 |
Locus ID | 11705 |
UniProt ID | Q5EC55 |
Cytogenetics | 10 39.72 cM |
Refseq Size | 1665 |
Refseq ORF | 1662 |
Synonyms | M; MIS |
Summary | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate N- and C-terminal cleavage products that homodimerize and associate to form a biologically active noncovalent complex. This complex binds to the anti-Mullerian hormone receptor type 2 and causes the regression of Mullerian ducts in the male embryo that would otherwise differentiate into the uterus and fallopian tubes. This protein also plays a role in Leydig cell differentiation and function and follicular development in adult females. Homozygous knockout male mice develop female reproductive organs and are often sterile, while homozygous knockout female mice exhibit premature depletion of primordial follicles. [provided by RefSeq, Jul 2016] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.