Tnfsf13b (NM_033622) Mouse Recombinant Protein

CAT#: TP525393

Purified recombinant protein of Mouse tumor necrosis factor (ligand) superfamily, member 13b (Tnfsf13b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR225393 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDESAKTLPPPCLCFCSEKGEDMKVGYDPITPQKEEGAWFGICRDGRLLAATLLLALLSSSFTAMSLYQL
  AALQADLMNLRMELQSYRGSATPAAAGAPELTAGVKLLTPAAPRPHNSSRGHRNRRAFQGPEETEQDVDL
  SAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIV
  VRQTGYFFIYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEG
  DEIQLAIPRENAQISRNGDDTFFGALKLL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 34.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_296371
• Locus ID: 24099
• UniProt ID: Q9WU72, Q3KP92
• Cytogenetics: 8 4.55 cM
• Refseq Size: 1710
• Refseq ORF: 930
• Synonyms: BAFF; BLyS; D8Ertd387e; TALL-1; TALL1; THANK; TNFSF20; Tnlg7a; zTNF4
• Summary: Cytokine that binds to TNFRSF13B/TACI and TNFRSF17/BCMA. TNFSF13/APRIL binds to the same 2 receptors. Together, they form a 2 ligands -2 receptors pathway involved in the stimulation of B- and T-cell function and the regulation of humoral immunity. A third B-cell specific BAFF-receptor (BAFFR/BR3) promotes the survival of mature B-cells and the B-cell response.[UniProtKB/Swiss-Prot Function]