Ranbp9 (NM_019930) Mouse Recombinant Protein

CAT#: TP523278

Purified recombinant protein of Mouse RAN binding protein 9 (Ranbp9), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR223278 representing NM_019930
  Red=Cloning site Green=Tags(s)
  
  MSGQPPPPPPQQQPPPPPPAAGAPGSGVALPAAAAASAGSSPAGSPGGGLGAAAAALLLHPPPPPPPPPA
  TAAPPPPASAAAPATAPPGLAVGPGPAAGVPVPGLAAGSSAAAPFPHGDSALNEQEKELQRRLKRLYPAV
  DEQETPLPRSWSPKDKFSYIGLSQNNLRVHYKGHGKTPKDAASVRATHPIPAACGIYYFEVKIVSKGRDG
  YMGIGLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINNTCFYTKNG
  HSLGIAFTDLPPNLYPTVGLQTPGEVVDANFGQHPFVFDIEDYMREWRTKIQAQIDRFPIGDREGEWQTM
  IQKMVSSYLVHHGYCATAEAFARSTDQTVLEELASIKNRQRIQKLVLAGRMGEAIETTQQLYPSLLERNP
  NLLFTLKVRQFIEMVNGTDSEVRCLGGRSPKSQDSYPVSPRPFSSPSMSPSHGMSIHSLAPGKSSTAHFS
  GFESCSNGVISNKAHQSYCHSKHQLSSLTVPELNSLNVSRSQQVNNFTSNDVDMETDHYSNGVGETSSNG
  FLNGSSKHDHEMEDCDTEMEVDCSQLRRQLCGGSQAAIERMIHFGRELQAMSEQLRRECGKNTANKKMLK
  DAFSLLAYSDPWNSPVGNQLDPIQREPVCSALNSAILETHNLPKQPPLALAMGQATQCLGLMARSGVGSC
  AFATVEDYLH
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 76.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_064314
• Locus ID: 56705
• UniProt ID: P69566, E9Q5D6
• Cytogenetics: 13 A4
• Refseq Size: 3064
• Refseq ORF: 2130
• Synonyms: IBAP-1; Ibap1; RanBPM
• Summary: May act as scaffolding protein, and as adapter protein to couple membrane receptors to intracellular signaling pathways. Acts as a mediator of cell spreading and actin cytoskeleton rearrangement. Core component of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1. May be involved in signaling of ITGB2/LFA-1 and other integrins. Enhances HGF-MET signaling by recruiting Sos and activating the Ras pathway. Enhances dihydrotestosterone-induced transactivation activity of AR, as well as dexamethasone-induced transactivation activity of NR3C1, but not affect estrogen-induced transactivation. Stabilizes TP73 isoform Alpha, probably by inhibiting its ubiquitination, and increases its proapoptotic activity. Inhibits the kinase activity of DYRK1A and DYRK1B. Inhibits FMR1 binding to RNA.[UniProtKB/Swiss-Prot Function]