Cacnb3 (NM_001044741) Mouse Recombinant Protein

CAT#: TP522874

Purified recombinant protein of Mouse calcium channel, voltage-dependent, beta 3 subunit (Cacnb3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR222874 representing NM_001044741
  Red=Cloning site Green=Tags(s)
  
  MSFSDSSATFLLNEGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQQLERAKHKPVAFAVRTNVSYC
  GVLDEECPVQGSGVNFEAKDFLHIKEKYSNDWWIGRLVKEGGDIAFIPSPQRLESIRLKQEQKARRSGNP
  SSLGDIGNRRSPPPSLAKQKQKQAEHVPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFDGR
  ISITRVTADLSLAKRSVLNNPGKRTIIERSSARSSIAEVQSEIERIFELAKSLQLVVLDADTINHPAQLA
  KTSLAPIIVFVKVSSPKVLQRLIRSRGKSQMKHLTVQMMAYDKLVQCPPESFDVILDENQLEDACEHLAE
  YLEVYWRATHHPAPGPGLLGPPSAIPGLQNQQLLGERVEEHSPLERDSLMPSDEASESSRQAWTGSSQRS
  SRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHDHNDRNWQRNRPWPKDSY
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Tag: C-MYC/DDK
• Predicted MW: 54.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001038206
• Locus ID: 12297
• UniProt ID: D3Z3Z3
• Cytogenetics: 15 54.64 cM
• Refseq Size: 2688
• Refseq ORF: 1449
• Synonyms: Beta3; Ca(v)beta3; CAB3; Cchb3
• Summary: Regulatory subunit of the voltage-gated calcium channel that gives rise to L-type calcium currents (PubMed:24751537). Increases CACNA1B peak calcium current and shifts the voltage dependencies of channel activation and inactivation (By similarity). Increases CACNA1C peak calcium current and shifts the voltage dependencies of channel activation and inactivation (By similarity).[UniProtKB/Swiss-Prot Function]