Poc1b (NM_027740) Mouse Recombinant Protein

CAT#: TP522485

Purified recombinant protein of Mouse POC1 centriolar protein B (Poc1b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR222485 representing NM_027740
  Red=Cloning site Green=Tags(s)
  
  MASGLEDPILERSFKGHKAAITSADFSPNCKQIATASWDTFLMLWSLKPHARAYRYVGHKDVVTSLQFSP
  QGNLLASASRDRTVRLWVLDRKGKSSEFKAHTAPVRSVDFSADGQLLVTASEDKSIKVWSMFRQRFLYSL
  YRHTHWVRCAKFSPDGRLIVSCSEDKTIKIWDTTNKQCVNNFSDSVGFANFVDFNPNGTCIASAGSDHAV
  KIWDIRMNKLLQHYQVHSCGVNCLSFHPLGNSLVTASSDGTVKMLDLIEGRLIYTLQGHTGPVFTVSFSK
  DGELLTSGGADAQVLIWRTNFIHLHCKDPKRNLKRLHFEASPHLLDIYPRSPHSHEDRKETIEINPKREV
  MDLQSSSPPVVDVLSFDSTTMTDSTYRAVPGKGEDICRYFLNPLLMPECSSTTVKKRPEDVSDVPSESLR
  SVPLAVADALEHIMEQLNILTQTVSILEQRLSLTEDKLRDCLENQQKLFSAVQQKS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 53.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_082016
• Locus ID: 382406
• UniProt ID: Q8BHD1
• Cytogenetics: 10 C3- D1
• Refseq Size: 2727
• Refseq ORF: 1428
• Synonyms: 4933430F16Rik; Wdr51b
• Summary: Plays an important role in centriole assembly and/or stability and ciliogenesis. Involved in early steps of centriole duplication, as well as in the later steps of centriole length control. Acts in concert with POC1A to ensure centriole integrity and proper mitotic spindle formation. Required for primary cilia formation, ciliary length and also cell proliferation. Required for retinal integrity.[UniProtKB/Swiss-Prot Function]