Mtif3 (NM_029581) Mouse Recombinant Protein
CAT#: TP520522
Purified recombinant protein of Mouse mitochondrial translational initiation factor 3 (Mtif3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Mtif3"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR220522 protein sequence
Red=Cloning site Green=Tags(s) MAVLLMRLMLQTTKLDHNLIGRCLQRHAVKPDPAQLSLSASTPKLLYLTSAKGFSTAGDPQGERKQKRRD AFSNTGRKISERIIRVLDEKGMDLGMMHRADVIRLMNKQDLRLVQRNTSSEPPEYQLMTGEQIHQERLKL REQEKAKPKTGPTMTKELVFSSNIGQHDLDTKSKQIQQWIEKKYHVQVTIKRRKDAEQSEEETEEIFNQI LQTMPDIATFSSRPKAIRGGTASMCVFRHLSKKEEKAYRESQESQRRDTLSKDDDGNSKESDVVCQ myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 31.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_083857 |
Locus ID | 76366 |
UniProt ID | Q9CZD5, A4QMQ0 |
Cytogenetics | 5 G3 |
Refseq Size | 4979 |
Refseq ORF | 831 |
Synonyms | 2810012L14Rik; AI414549 |
Summary | IF-3 binds to the 28S ribosomal subunit and shifts the equilibrum between 55S ribosomes and their 39S and 28S subunits in favor of the free subunits, thus enhancing the availability of 28S subunits on which protein synthesis initiation begins.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.