Cd33 (NM_021293) Mouse Recombinant Protein

CAT#: TP519960

Purified recombinant protein of Mouse CD33 antigen (Cd33), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR219960 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLWPLPLFLLCAGSLAQDLEFQLVAPESVTVEEGLCVHVPCSVFYPSIKLTLGPVTGSWLRKGVSLHEDS
  PVATSDPRQLVQKATQGRFQLLGDPQKHDCSLFIRDAQKNDTGMYFFRVVREPFVRYSYKKSQLSLHVTS
  LSRTPDIIIPGTLEAGYPSNLTCSVPWACEQGTPPTFSWMSTALTSLSSRTTDSSVLTFTPQPQDHGTKL
  TCLVTFSGAGVTVERTIQLNVTRKSGQMRELVLVAVGEATVKLLILGLCLVFLIVMFCRRKTTKLSVHMG
  CENPIKAHQQDSKVHSNPENPRPLQKDSPQEQSSVHTKISLDFMGGKPQEYSEI
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 37 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_067268
• Locus ID: 12489
• UniProt ID: Q63994
• Cytogenetics: 7 28.25 cM
• Refseq Size: 2488
• Refseq ORF: 1005
• Synonyms: gp67; Siglec-3
• Summary: Sialic-acid-binding immunoglobulin-like lectin (Siglec) that plays a role in mediating cell-cell interactions and in maintaining immune cells in a resting state (By similarity). Preferentially binds sialic acid to the short O-linked glycans of certain mucins (PubMed:12773563).[UniProtKB/Swiss-Prot Function]