Rab12 (NM_024448) Mouse Recombinant Protein
CAT#: TP518969
Purified recombinant protein of Mouse RAB12, member RAS oncogene family (Rab12), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Rab12"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR218969 representing NM_024448
Red=Cloning site Green=Tags(s) MDPSAALHRRPAGGSLGAVSPALSGGQARRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEAC KSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMID KYASEDAELLLVGNKLDCETDREISRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLD VLRNELSNSILSLQPEPEIPPELPPPRPHVRCC myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 27.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_077768 |
Locus ID | 19328 |
UniProt ID | P35283 |
Cytogenetics | 17 E1.1 |
Refseq Size | 2010 |
Refseq ORF | 729 |
Synonyms | 2900054P15Rik; AW555448; C77700 |
Summary | The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion (By similarity). That Rab may play a role in protein transport from recycling endosomes to lysosomes regulating, for instance, the degradation of the transferrin receptor. Involved in autophagy.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.