Gja8 (NM_008123) Mouse Recombinant Protein

CAT#: TP518273

Purified recombinant protein of Mouse gap junction protein, alpha 8 (Gja8), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR218273 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGDWSFLGNILEEVNEHSTVIGRVWLTVLFIFRILILGTAAEFVWGDEQSDFVCNTQQPGCENVCYDEAF
  PISHIRLWVLQIIFVSTPSLMYVGHAVHHVRMEEKRKDREAEELCQQSRSNGGERVPIAPDQASIRKSSS
  SSKGTKKFRLEGTLLRTYVCHIIFKTLFEVGFIVGHYFLYGFRILPLYRCSRWPCPNVVDCFVSRPTEKT
  IFILFMLSVAFVSLFLNIMEMSHLGMKGIRSAFKRPVEQPLGEIAEKSLHSIAVSSIQKAKGYQLLEEEK
  IVSHYFPLTEVGMVETSPLSAKPFSQFEEKIGTGPLADMSRSYQETLPSYAQVGVQEVEREEPPIEEAVE
  PEVGEKKQEAEKVAPEGQETVAVPDRERVETPGVGKEDEKEELQAEKVTKQGLSAEKAPSLCPELTTDDN
  RPLSRLSKASSRARSDDLTI
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 49.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_032149
• Locus ID: 14616
• UniProt ID: P28236, Q548M7
• Cytogenetics: 3
• Refseq Size: 6989
• Refseq ORF: 1323
• Synonyms: Aey5; Cnx50; Cx50; Lop10
• Summary: Structural component of eye lens gap junctions (PubMed:1325220). Gap junctions are dodecameric channels that connect the cytoplasm of adjoining cells. They are formed by the docking of two hexameric hemichannels, one from each cell membrane (By similarity). Small molecules and ions diffuse from one cell to a neighboring cell via the central pore (PubMed:1325220).[UniProtKB/Swiss-Prot Function]