Sema4a (NM_001163491) Mouse Recombinant Protein

CAT#: TP517872

Purified recombinant protein of Mouse sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A (Sema4a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR217872 representing NM_001163491
  Red=Cloning site Green=Tags(s)
  
  MALPSLGQDSWSLLRVFFFQLFLLPSLPPASGTGGQGPMPRVKYHAGDGHRALSFFQQKGLRDFDTLLLS
  DDGNTLYVGAREAVLALNIQNPGIPRLKNMIPWPASERKKTECAFKKKSNETQCFNFIRVLVSYNATHLY
  ACGTFAFSPACTFIELQDSLLLPILIDKVMDGKGQSPFDPVHKHTAVLVDGMLYSGTMNNFLGSEPILMR
  TLGSQPVLKTDIFLRWLHADASFVAAIPSTQVVYFFFEETASEFDFFEELYISRVAQVCKNDVGGEKLLQ
  KKWTTFLKAQLLCAQPGQLPFNIIRHAVLLPADSPSVSRIYAVFTSQWQVGGTRSSAVCAFSLTDIERVF
  KGKYKELNKETSRWTTYRGSEVSPRPGSCSMGPSSDKALTFMKDHFLMDEHVVGTPLLVKSGVEYTRLAV
  ESARGLDGSSHVVMYLGTSTGSLHKAVVPQDSSAYLVEEIQLSPDSEPVRNLQLAPAQGAVFAGFSGGIW
  RVPRANCSVYESCVDCVLARDPHCAWDPESRLCSLLSGSTKPWKQDMERGNPEWVCTRGPMARSPRRQSP
  PQLIKEVLTVPNSILELPCPHLSALASYHWSHGRAKISEASATVYNGSLLLLPQDGVGGLYQCVATENGY
  SYPVVSYWVDSQDQPLALDPELAGVPRERVQVPLTRVGGGASMAAQRSYWPHFLIVTVLLAIVLLGVLTL
  LLASPLGALRARGKVQGCGMLPPREKAPLSRDQHLQPSKDHRTSASDVDADNNHLGAEVA
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 83.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001156963
• Locus ID: 20351
• UniProt ID: Q62178
• Cytogenetics: 3 F1
• Refseq Size: 3084
• Refseq ORF: 2280
• Synonyms: AI132332; Semab; SemB
• Summary: Cell surface receptor for PLXNB1, PLXNB2, PLXNB3 and PLXND1 that plays an important role in cell-cell signaling (PubMed:20043131, PubMed:17318185). Regulates glutamatergic and GABAergic synapse development (PubMed:29981480). Promotes the development of inhibitory synapses in a PLXNB1-dependent manner and promotes the development of excitatory synapses in a PLXNB2-dependent manner (PubMed:29981480). Plays a role in priming antigen-specific T-cells, promotes differentiation of Th1 T-helper cells, and thereby contributes to adaptive immunity (PubMed:15780988). Promotes phosphorylation of TIMD2 (PubMed:12374982). Inhibits angiogenesis (PubMed:17318185). Promotes axon growth cone collapse (PubMed:20043131). Inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons (PubMed:20043131).[UniProtKB/Swiss-Prot Function]