Sntg1 (NM_027671) Mouse Recombinant Protein

CAT#: TP517591

Purified recombinant protein of Mouse syntrophin, gamma 1 (Sntg1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR217591 representing NM_027671
  Red=Cloning site Green=Tags(s)
  
  MDFRTTCEETKTGVCLLQDGNQEPFKVRLHLARDLLMLQEQDVLCVSGEPFYSGERTVTIRRQTVGGFGL
  SIKGGAEHNIPVVISKISKEQRAELSGLLFIGDAILQINGINVRKCRHEEVVQVLRNAGEEVTLTVSFLK
  RAPAFLKLPVNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPGLRWEKRWCDLRLIP
  LLHARFSQYVPGTDLSRQNAFQVVAVDGVCSGILQCLSAEDCMDWLQAIASNISNLTKHNIKKINRNFPV
  NQQIVYMGWCEAREQESLQDRVYTPVFLALRGSCLYRFLSPPVTTWDWTRAEKTFSVCEIMCKVLKDSDL
  LDRRKHCFTMQSECGEDLYFSVELESDLAQWERAFQTATFLEVERIQCKTYACVLESHLMGLTIDFSTGF
  ICFDAATKAVLWRYKFSQLKGSSDDGKSKIKFLFQNPDTKQIEAKELEFSNLFAVLHCIHSFFAAKVACL
  DPLFLGNQAATTAAVSSASTSKAKHLA
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 58 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_081947
• Locus ID: 71096
• UniProt ID: Q8C415, Q8BNW6, Q8CAI8
• Cytogenetics: 1 A1-A2
• Refseq Size: 7267
• Refseq ORF: 1551
• Synonyms: 4933426D16Rik; G1SYN; SYN4
• Summary: Adapter protein that binds to and probably organizes the subcellular localization of a variety of proteins. May link various receptors to the actin cytoskeleton and the dystrophin glycoprotein complex. May participate in regulating the subcellular location of diacylglycerol kinase-zeta to ensure that diacylglycerol is rapidly inactivated following receptor activation (By similarity).[UniProtKB/Swiss-Prot Function]