Pphln1 (NM_175363) Mouse Recombinant Protein
CAT#: TP517466
Purified recombinant protein of Mouse periphilin 1 (Pphln1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Pphln1"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR217466 representing NM_175363
Red=Cloning site Green=Tags(s) MWSEGRYDYDRLPRERVPPRSHPSDESGYRWLRDDHSTSRQPDYRDMRDGFRRKSFYSSHYSRDRSPHKR DAPFFRESPVGRKDSPHSRSGSSVSSRSYSPERSRTHSFHQSQHRKSSRVGASYKRQNEAIRGRGKERSI QSVKTSRDASPSSSSAVASSKALDKPSRLTEKELAEAESKWANETLEKSDESNLAEMNEFEAGSTAPLFI DQTEEPESNTVDGTELYEDSQLSNRSKAIASKTKEIEQVYRQDCETFGMVVKMLIEKDPSLEKSVQFALR QNLHEIGERCVEELKRFITEYDNSAQDFGDPF SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-MYC/DDK |
Predicted MW | 36.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_780572 |
Locus ID | 223828 |
UniProt ID | Q8K2H1, Q3UBL8, Q3TYM7 |
Cytogenetics | 15 E3 |
Refseq Size | 3828 |
Refseq ORF | 936 |
Synonyms | CR; HSPC206; HSPC232 |
Summary | Component of the HUSH complex, a multiprotein complex that mediates epigenetic repression. The HUSH complex is recruited to genomic loci rich in H3K9me3 and is probably required to maintain transcriptional silencing by promoting recruitment of SETDB1, a histone methyltransferase that mediates further deposition of H3K9me3. In the HUSH complex, contributes to the maintenance of the complex at chromatin. Acts as a transcriptional corepressor and regulates the cell cycle, probably via the HUSH complex. The HUSH complex is also involved in the silencing of unintegrated retroviral DNA: some part of the retroviral DNA formed immediately after infection remains unintegrated in the host genome and is transcriptionally repressed. May be involved in epithelial differentiation by contributing to epidermal integrity and barrier formation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.