Cpne6 (NM_001146183) Mouse Recombinant Protein

CAT#: TP517305

Purified recombinant protein of Mouse copine VI (Cpne6), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR217305 representing NM_001146183
  Red=Cloning site Green=Tags(s)
  
  MSDPEMGWVPEPPAMTLGASRVELRVSCHGLLDRDTLTKPHPCVLLKLYSDEQWVEVERTEVLRSCSSPV
  FSRVLAIEYFFEEKQPLQFHVFDAEDGATSPSSDTFLGSTECTLGQIVSQTKVTKPLLLKNGKTAGKSTI
  TIVAEEVSGTNDYVQLTFRAHKLDNKDLFSKSDPFMEIYKTNGDQSDQLVWRTEVVKNNLNPSWEPFRLS
  LHSLCSCDIHRPLKFLVYDYDSSGKHDFIGEFTSTFQEMQEGTANPGQEMQWDCINPKYRDKKKNYKSSG
  TVVLAQCTVEKVHTFLDYIMGGCQISFTVAIDFTASNGDPRSSQSLHCLSPRQPNHYLQALRTVGGICQD
  YDSDKRFPAFGFGARIPPNFEVSHDFAINFDPENPECEEISGVIASYRRCLPQIQLYGPTNVAPIINRVA
  EPAQREQSTGQATYSVLLVLTDGVVSDMAETRTAIVRASRLPMSIIIVGVGNADFSDMRLLDGDDGPLRC
  PKGVPAARDIVQFVPFRDFKDAAPSALAKCVLAEVPRQVVEYYASQGISPGAPRPSTPAMTPSPSP
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 62.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001139655
• Locus ID: 12891
• UniProt ID: Q3UYN2
• Cytogenetics: 14 C3
• Refseq Size: 2192
• Refseq ORF: 1668
• Synonyms: AU067659; BB076446
• Summary: Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encodes a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2018]