Arid3c (NM_001017362) Mouse Recombinant Protein

CAT#: TP517263

Purified recombinant protein of Mouse AT rich interactive domain 3C (BRIGHT-like) (Arid3c), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR217263 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEALQRQQAARLAQGVGPLAPPRLPLPQPPLLGARTLQAPEGAIGVVGAEEEEGAEDEEGETPLAEEETA
  EQSHPGARCPNSPSSQSPGIQPHEWTYEEQFKQLYELDADPKRKEFLDDLFSFMQKRGTPVNRVPIMAKQ
  VLDLYALFRLVTAKGGLVEVINRKVWREVTRGLSLPTTITSAAFTLRTQYMKYLYPYECETRALSSPGEL
  QAAIDSNRREGRRQAYTAVPLFNLAGPTPRGAPGPASSHGPAPTATPNCPGPTQGSASGLPAHACAQLSP
  SPVKKEESGIPPPRLALPMGLASEATREKLAPEEPPEKRAVLMGPVDSPRLGAPPSFLPRGKAPLREERL
  DGPLNLAGSGISSINVALEINGVVYTGILFARRQPVPASLGPTNPPPLPSTGPPSSTLP
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 43.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001017362
• Locus ID: 550619
• UniProt ID: A6PWV5
• Cytogenetics: 4 A5
• Refseq Size: 1751
• Refseq ORF: 1230
• Summary: This gene is a member of the ARID (AT-rich interaction domain) family of proteins. The ARID domain is a helix-turn-helix motif-based DNA-binding domain. ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification. [provided by RefSeq, Jul 2008]