Dph1 (NM_144491) Mouse Recombinant Protein

CAT#: TP516667

Purified recombinant protein of Mouse diphthamide biosynthesis 1 (Dph1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR216667 representing NM_144491
  Red=Cloning site Green=Tags(s)
  
  MAALVVSETAEPGSRVGPGRGRISRGRLANQIPPEVLNNPQLQAAVQVLPSNYNFEIPKTIWRIQQAQAK
  KVALQMPEGLLLFACTIVDILERFTEAEVMVMGDVTYGACCVDDFTARALGVDFLVHYGHSCLVPMDTSV
  QDFRVLYVFVDIRIDTAHLLDSVRLTFTPGSSLALVSTIQFVSTLQAAAQELKADYHISVPQCKPLSPGE
  ILGCTSPRLSKEVEAVVYLGDGRFHLESVMIANPNIPAYRYDPYGKVLSREYYDHQRMQATRQEAIAAAR
  SAKSWGLILGTLGRQGSPKILEHLESQLRNLGLPFVRLLLSEIFPSKLSLLPEVDVWVQVACPRLSIDWG
  SAFPKPLLTPYEAAVALKDISWQQPYPMDFYSGSSLGPWTVNYGRDRAPRGLCQPASDKVQQGSRGGSPA
  PACESCNCADQKATSPAP
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 48.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_652762
• Locus ID: 116905
• UniProt ID: Q5NCQ5
• Cytogenetics: 11 45.76 cM
• Refseq Size: 2103
• Refseq ORF: 1314
• Synonyms: 2310011M22Rik; 4930488F09Rik; AW551873; Dph2l1; Ovca1
• Summary: Required for the first step in the synthesis of diphthamide, a post-translational modification of histidine which occurs in translation elongation factor 2 (EEF2). Acts also as a tumor suppressor in lung and breast cancers. Plays a role in embryonic growth, organogenesis and postnatal survival. When overexpressed, suppresses colony formation ability and growth rate of ovarian cancer cells (By similarity).[UniProtKB/Swiss-Prot Function]