OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Dph1 (NM_144491) Mouse Recombinant Protein

Be the first to review this product
SKU
TP516667
Purified recombinant protein of Mouse diphthamide biosynthesis 1 (Dph1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Dph1 or NM_144491"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR216667 representing NM_144491
Red=Cloning site Green=Tags(s)

MAALVVSETAEPGSRVGPGRGRISRGRLANQIPPEVLNNPQLQAAVQVLPSNYNFEIPKTIWRIQQAQAK
KVALQMPEGLLLFACTIVDILERFTEAEVMVMGDVTYGACCVDDFTARALGVDFLVHYGHSCLVPMDTSV
QDFRVLYVFVDIRIDTAHLLDSVRLTFTPGSSLALVSTIQFVSTLQAAAQELKADYHISVPQCKPLSPGE
ILGCTSPRLSKEVEAVVYLGDGRFHLESVMIANPNIPAYRYDPYGKVLSREYYDHQRMQATRQEAIAAAR
SAKSWGLILGTLGRQGSPKILEHLESQLRNLGLPFVRLLLSEIFPSKLSLLPEVDVWVQVACPRLSIDWG
SAFPKPLLTPYEAAVALKDISWQQPYPMDFYSGSSLGPWTVNYGRDRAPRGLCQPASDKVQQGSRGGSPA
PACESCNCADQKATSPAP

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 48.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_652762
Locus ID 116905
UniProt ID Q5NCQ5
Cytogenetics 11 45.76 cM
RefSeq Size 2103
RefSeq ORF 1314
Synonyms 2310011M22Rik; 4930488F09Rik; AW551873; Dph2l1; Ovca1
Summary Required for the first step in the synthesis of diphthamide, a post-translational modification of histidine which occurs in translation elongation factor 2 (EEF2). Acts also as a tumor suppressor in lung and breast cancers. Plays a role in embryonic growth, organogenesis and postnatal survival. When overexpressed, suppresses colony formation ability and growth rate of ovarian cancer cells (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products