Ptges3 (NM_019766) Mouse Recombinant Protein

CAT#: TP515806

Purified recombinant protein of Mouse prostaglandin E synthase 3 (Ptges3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR215806 representing NM_019766
  Red=Cloning site Green=Tags(s)
  
  MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTD
  RSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMDHMGGDEDVDLPE
  VDGADDDSQDSDDEKMPDLE
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 19.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_062740
• Locus ID: 56351
• UniProt ID: Q9R0Q7
• Cytogenetics: 10 D3
• Refseq Size: 1954
• Refseq ORF: 480
• Synonyms: 5730442A20Rik; cPGES; p23; Ptges; sid3177; Tebp
• Summary: Cytosolic prostaglandin synthase that catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). Molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes. Facilitates HIF alpha proteins hydroxylation via interaction with EGLN1/PHD2, leading to recruit EGLN1/PHD2 to the HSP90 pathway.[UniProtKB/Swiss-Prot Function]