Syce3 (NM_001162882) Mouse Recombinant Protein

CAT#: TP515444

Purified recombinant protein of Mouse synaptonemal complex central element protein 3 (Syce3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR215444 representing NM_001162882
  Red=Cloning site Green=Tags(s)
  
  MADSDPGERSYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFLNCK
  EEMEKNWQELLTETKRKQ
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 10.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001156354
• Locus ID: 75459
• UniProt ID: B5KM66, E7D6R1
• Cytogenetics: 15 E3
• Refseq Size: 478
• Refseq ORF: 264
• Synonyms: 1700007E06Rik; TSEG-2; TSEG2
• Summary: Major component of the transverse central element of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Required for chromosome loading of the central element-specific SCS proteins, and for initiating synapsis between homologous chromosomes. Chromosome loading appears to require SYCP1. Required for fertility. May play a role in apoptosis of spermatogenic cells and pathogenesis of cryptorchidism.[UniProtKB/Swiss-Prot Function]