Cyp2w1 (NM_001160265) Mouse Recombinant Protein

CAT#: TP514072

Purified recombinant protein of Mouse cytochrome P450, family 2, subfamily w, polypeptide 1 (Cyp2w1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR214072 representing NM_001160265
  Red=Cloning site Green=Tags(s)
  
  MALLLLGVWGILLLLGLWGLLQGCTRSPSLAPRWPPGPRPLPFLGNLHLLGVTQQDRALMELSERYGPMF
  TIHLGSQKTVVLSGYEVVREALVGTGHELADRPPIPIFQHIQRGGGIFFSSGARWRAGRQFTVRTLQSLG
  VQQPSMVGKVLQELACLKGQLDSYGGQPLPLALLGWAPCNITFTLLFGQRFDYQDPVFVSLLSLIDQVMV
  LLGSPGIQLFNTFPRLGAFLRLHRPVLSKIEEVRTILRTLLETRRPPLPTGGPAQSYVEALLQQGQEDDP
  EDMFGEANVLACTLDMVMAGTETTAATLQWAVFLMVKHPHVQGRVQEELDRVLGPGQLPQPEHQRALPYT
  SAVLHEVQRYITLLPHVPRCTAADIQLGGYLLPKGTPVIPLLTSVLLDKTQWETPSQFNPNHFLDAKGRF
  MKRGAFLPFSAGRRVCVGKSLARTELFLLFAGLLQRYRLLPPPGLSPADLDLRPAPAFTMRPPAQTLCVV
  PRS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 54.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001153737
• Locus ID: 545817
• UniProt ID: E9Q816
• Cytogenetics: 5 G2
• Refseq Size: 1512
• Refseq ORF: 1479
• Synonyms: Gm455
• Summary: Seems to have broad catalytic activity towards several chemicals, including polycyclic aromatic hydrocarbon dihydrodiols and aromatic amines. Active also in the metabolism of indoline substrates and is able to activate aflatoxin B1 into cytotoxic products. Furthermore, it seems to be involved in the oxydation of lysophospholipids and fatty acids.[UniProtKB/Swiss-Prot Function]