Tut1 (NM_197993) Mouse Recombinant Protein

CAT#: TP511013

Purified recombinant protein of Mouse terminal uridylyl transferase 1, U6 snRNA-specific (Tut1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR211013 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAVDSDVVSLPRGRFRCCLCDVTTANRPSLDAHLKGRKHRDLVQLRATRKAQGLRSVFVSGFPRDVGSA
  QLSEYFQTFGPVANIVMDKDKGVFAIVEMGDISAREAVLSQPKHSLGGHGLRVRPREQKEFQSPASKSPK
  GVDSSSHQLVQALAEAADVGAQMVKLVELRELSEAERQLRNLVVALMQEVFTEFFPGCVVHPFGSTVNSF
  DVHGCDLDLFLDMGDMEETEPDPKAPKVPETSSLDSALASSLDPQALACTPASPLDSLSPTSVQESESLD
  FDTPSSLAPQTPDSALGSDTVTSPQSLPPVSPLQEDRKEGKQGKELELAEEASKDEKEEAAAVLELVGSI
  LRGCVPGVYRVQTVPSARRPVVKFCHRPSGLHGDVSLSNRLALYNSRFLNLCSEMDGRVRPLVYTLRCWA
  QHNGLSGGGPLLNNYALTLLVIYFLQTRDPPVLPTVAQLTQRAGEGEQVEVDGWDCSFPKDASRLEPSTN
  VEPLSSLLAQFFSCVSCLDLSGSLLSLREGRPLMVAEGLPSDLWEGLRLGPMNLQDPFDLSHNVAANVTG
  RVAKRLQSCCGAAASYCRSLQYQQRSSRGRDWGLLPLLQPSSPSSLLSAKLIPLPSAPFPQVIMALVDVL
  REALGCHIEQGTKRRRSEGARIKDSPLGGVNKRQRLGGQEKSFEEGKEEPQGCAGDHSENEVEEMVIEVR
  ETPQDWALLHSGPPEEELPLMTANCLDKAAEHNPMKPEVAGEGSQGETGKEASHPSSVSWRCALWHQVWQ
  GRRRARRRLQQQTKEEGRGGPTTGAEWLAMEARVTQELKGPNSEQERPPGEPLLSFVASASQAEQTLTVA
  PLQDSQGLFPGLHHFLQGFIPQALKNLLK
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 94.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_932110
• Locus ID: 70044
• UniProt ID: Q8R3F9
• Cytogenetics: 19 A
• Refseq Size: 2764
• Refseq ORF: 2610
• Synonyms: 2700038E08Rik; PAPD2; Rbm21; star-PAP; TUTase6; U6-TUTase
• Summary: Poly(A) polymerase that creates the 3'-poly(A) tail of specific pre-mRNAs. Localizes to nuclear speckles together with PIP5K1A and mediates polyadenylation of a select set of mRNAs, such as HMOX1. In addition to polyadenylation, it is also required for the 3'-end cleavage of pre-mRNAs: binds to the 3' UTR of targeted pre-mRNAs and promotes the recruitment and assembly of the CPSF complex on the 3' UTR of pre-mRNAs. In addition to adenylyltransferase activity, also has uridylyltransferase activity. However, the ATP ratio is higher than UTP in cells, suggesting that it functions primarily as a poly(A) polymerase. Acts as a specific terminal uridylyltransferase for U6 snRNA in vitro: responsible for a controlled elongation reaction that results in the restoration of the four 3'-terminal UMP-residues found in newly transcribed U6 snRNA. Not involved in replication-dependent histone mRNA degradation (By similarity).[UniProtKB/Swiss-Prot Function]