Vil1 (NM_009509) Mouse Recombinant Protein

CAT#: TP510849

Purified recombinant protein of Mouse villin 1 (Vil1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR210849 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTKLNAQVKGSLNITTPGIQIWRIEAMQMVPVPSSTFGSFFDGDCYVVLAIHKTSSTLSYDIHYWIGQDS
  SQDEQGAAAIYTTQMDDYLKGRAVQHREVQGNESETFRSYFKQGLVIRKGGVASGMKHVETNSCDVQRLL
  HVKGKRNVLAGEVEMSWKSFNRGDVFLLDLGKLIIQWNGPESNRMERLRGMALAKEIRDQERGGRTYVGV
  VDGEKEGDSPQLMAIMNHVLGPRKELKAAISDSVVEPAAKAALKLYHVSDSEGKLVVREVATRPLTQDLL
  KHEDCYILDQGGLKIFVWKGKNANAQERSGAMSQALNFIKAKQYPPSTQVEVQNDGAESPIFQQLFQKWT
  VPNRTSGLGKTHTVGSVAKVEQVKFDALTMHVQPQVAAQQKMVDDGSGEVQVWRIEDLELVPVESKWLGH
  FYGGDCYLLLYTYLIGEKQHYLLYIWQGSQASQDEIAASAYQAVLLDQKYNDEPVQIRVTMGKEPPHLMS
  IFKGRMVVYQGGTSRKNNLEPVPSTRLFQVRGTNADNTKAFEVTARATSLNSNDVFILKTPSCCYLWCGK
  GCSGDEREMAKMVADTISRTEKQVVVEGQEPANFWMALGGKAPYANTKRLQEENQVITPRLFECSNQTGR
  FLATEIFDFNQDDLEEEDVFLLDVWDQVFFWIGKHANEEEKKAAATTVQEYLKTHPGNRDLETPIIVVKQ
  GHEPPTFTGWFLAWDPFKWSNTKSYDDLKAELGNSGDWSQIADEVMSPKVDVFTANTSLSSGPLPTFPLE
  QLVNKSVEDLPEGVDPSRKEEHLSTEDFTRALGMTPAAFSALPRWKQQNIKKEKGLF
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 92.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_033535
• Locus ID: 22349
• UniProt ID: Q62468, Q8CEJ4
• Cytogenetics: 1 38.54 cM
• Refseq Size: 3117
• Refseq ORF: 2484
• Synonyms: Vil
• Summary: Epithelial cell-specific Ca(2+)-regulated actin-modifying protein that modulates the reorganization of microvillar actin filaments. Plays a role in the actin nucleation, actin filament bundle assembly, actin filament capping and severing. Binds phosphatidylinositol 4,5-bisphosphate (PIP2) and lysophosphatidic acid (LPA); binds LPA with higher affinity than PIP2. Binding to LPA increases its phosphorylation by SRC and inhibits all actin-modifying activities. Binding to PIP2 inhibits actin-capping and -severing activities but enhances actin-bundling activity. Regulates the intestinal epithelial cell morphology, cell invasion, cell migration and apoptosis. Protects against apoptosis induced by dextran sodium sulfate (DSS) in the gastrointestinal epithelium. Appears to regulate cell death by maintaining mitochondrial integrity. Enhances hepatocyte growth factor (HGF)-induced epithelial cell motility, chemotaxis and wound repair. Upon S.flexneri cell infection, its actin-severing activity enhances actin-based motility of the bacteria and plays a role during the dissemination.[UniProtKB/Swiss-Prot Function]