Sarm1 (NM_172795) Mouse Recombinant Protein

CAT#: TP510296

Purified recombinant protein of Mouse sterile alpha and HEAT/Armadillo motif containing 1 (Sarm1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Purified recombinant protein Sarm1 was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR210296 representing NM_172795
  Red=Cloning site Green=Tags(s)
  
  MVLTLLFSAYKLCRFFTMSGPRPGADRLTVPGPDRSGGASPWWAAGGRGSREVSPGVGTEVQGALERSLP
  ELQQALSELKQASAARAVGAGLAEVFQLVEEAWLLPAVGREVAQGLCDAIRLDGGLDLLLRLLQAPELET
  RVQAARLLEQILVAENRDRVARIGLGVILNLAKEREPVELARSVAGILEHMFKHSEETCQRLVAAGGLDA
  VLYWCRRTDPALLRHCALALANCALHGGQTVQRCMVEKRAAEWLFPLAFSKEDELLRLHACLAVAVLATN
  KEVEREVEHSGTLALVEPLVASLDPGRFARCLVDASDTSQGRGPDDLQSLVLLLDSSRLEAQCIGAFYLC
  AEAAIKSLQGKTKVFSDIGAIQSLKRLVSYSTNGTTSALAKRALRLLGEEVPRRILPCVASWKEAEVQTW
  LQQIGFSQYCENFREQQVDGDLLLRLTDEELQTDLGMKSSITRKRFFRELTELKTFASYATCDRSNLADW
  LGSLDPRFRQYTYGLVSCGLDRSLLHRVSEQQLLEDCGIRLGVHRTRILSAAREMLHSPLPCTGGKLSGD
  TPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVIAARNFVLVLSAGALDKCM
  QDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQALPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQ
  GRPSQDSSAGSDTSLEGATPMGLP
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 80.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_766383
• Locus ID: 237868
• UniProt ID: Q6PDS3
• Cytogenetics: 11 46.74 cM
• Refseq Size: 5044
• Refseq ORF: 2172
• Synonyms: A830091I15Rik; C78606; MyD885; Sarm
• Summary: Negative regulator of MYD88- and TRIF-dependent toll-like receptor signaling pathway which plays a pivotal role in activating axonal degeneration following injury. Promotes Wallerian degeneration an injury-induced axonal death pathway which involves degeneration of an axon distal to the injury site. Can activate neuronal death in response to stress. Regulates dendritic arborization through the MAPK4-JNK pathway. Involved in innate immune response. Inhibits both TICAM1/TRIF- and MYD88-dependent activation of JUN/AP-1, TRIF-dependent activation of NF-kappa-B and IRF3, and the phosphorylation of MAPK14/p38. Can restrict West Nile virus (WNV) pathogenesis.[UniProtKB/Swiss-Prot Function]