Spire2 (NM_172287) Mouse Recombinant Protein

CAT#: TP510260

Purified recombinant protein of Mouse spire type actin nucleation factor 2 (Spire2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR210260 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MARAGGGGAAAPERAGGAARPEPWELSLEEVLKVYEQPINEEQAWAVCFQGCRGLRGEPGGVRRIRDTAD
  ILLRRDGSVGARLEPEPTTMVVPPASSEAQMVQSLGFAIYRALDWGLDENEERELSPQLERLIDLMANSD
  CEDSSCGAADEGYVGPEEEEEAEGGPRAVRTFAQAMRLCALRLTDPHGAQAHYQAVCRALFVETLELRAF
  LARVREAKEMLKKLGEEEPREKPLAELDHLGHTDWARLWVQLMRELRHGVKLKKVQEKEFNPLPTEFQLT
  PFEMLMQDIRARNYKLRKVMVDGDIPPRVKKDAHELILDFIRSRPPLKQVSERQLRPVPQKQRTLHEKIL
  EEIKQERRLRPVGAQHLGGRGFGSLPCILNACSGDIKSTSCINLSVTDTGSGSQRPRPRVLLKAPTLAEM
  EEMNTSEEEESPCGEVALKRDRSFSEHDLAQLRSEMASGLQSAAQPPGGTEPPRARAGSMHSWRPSSRDQ
  GFCPVSGQSQPLPSSALPSSLSSVDGPEAASPDTRHLWLEFSHPVESLALTVEEVVDVRRVLVKAEMERF
  LQDKELFSSLKRGKICCCCRAKFPLFSWPPTCLFCKRAVCTSCSVKMKMPSKKYGHIPVYTLGFESLQRV
  PTTKATPTLRRDAFQSLQGPKWRSVEEEFPHIYAHGCVLKDVCSDCTSFVADVVCSSRKSVDVLNATPRR
  SRQTQSLYIPNTRTLNFQ
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 80.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_758491
• Locus ID: 234857
• UniProt ID: Q8K1S6
• Cytogenetics: 8 E1
• Refseq Size: 2399
• Refseq ORF: 2157
• Synonyms: BC026502; Spir-2; Spir2
• Summary: Acts as an actin nucleation factor, remains associated with the slow-growing pointed end of the new filament (PubMed:21620703, PubMed:21983562). Involved in intracellular vesicle transport along actin fibers, providing a novel link between actin cytoskeleton dynamics and intracellular transport (PubMed:21983562). Required for asymmetric spindle positioning and asymmetric cell division during oocyte meiosis (PubMed:21620703). Required for normal formation of the cleavage furrow and for polar body extrusion during female germ cell meiosis (PubMed:21620703). Also acts in the nucleus: together with SPIRE1 and SPIRE2, promotes assembly of nuclear actin filaments in response to DNA damage in order to facilitate movement of chromatin and repair factors after DNA damage (By similarity).[UniProtKB/Swiss-Prot Function]