Calcoco1 (NM_026192) Mouse Recombinant Protein

CAT#: TP510067

Purified recombinant protein of Mouse calcium binding and coiled coil domain 1 (Calcoco1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR210067 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEESSLSRAPSRGGVNFLNVARTYIPNTKVECHYTLPPGTMPSASDWIGIFKVEAACVRDYHTFVWSSVP
  ESTTDGSPTHASVQFQASYLPKPGAQLYQFRYVNRQGRVCGQSPPFQFREPRPMDELVTLEEADGGSDIL
  LVVPKATVLQNQLDESQQERNDLMQLKLQLEDQVTELRSRVQELEAALATARQEHSELTEQYKGLSRSHG
  ELSEERDILSQQQGDHVARILELEDDIQTMSDKVLMKEVELDRVRDTVKALTREQEKLLRQLKEFQADKE
  QSEAELQTVREENCCLNTELEEAKSRQEEQGAQVQRLKDKLAHMKDTLGQAQQKVAELEPLKEQLRGVQE
  LAASSQQKAALLGEELASAAGARDRTIAELHRSRLEVAEVNGRLAELSLHMKEEKCQWSKERTGLLQSME
  AEKDKILKLSAEILRLEKTVQEERTQSHVFKTELAREKDSSLVQLSESKRELTELRSALRVLQKEKEQLQ
  TEKQELLEYMRKLEARLEKVADEKWTEDAATEDEEATAGLSCPASLTDSEDESPEDMRLPSYGLCESGNT
  SSSPPGPREPSSLVVINQPAPIAPQFSGPGEASSSDSEAEDEKSVLMAAVQSGGEEASLLLPELGSAFYD
  VASAFTVSSLSEASPGVPANPPWKECPICKERFPAESDKDALEGHMDGHFFFSTQDPFTFE
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 77.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_080468
• Locus ID: 67488
• UniProt ID: Q8CGU1
• Cytogenetics: 15
• Refseq Size: 2840
• Refseq ORF: 2076
• Synonyms: 1810009B06Rik; Cocoa; Gcap11; mKIAA1536
• Summary: Functions as a coactivator for aryl hydrocarbon and nuclear receptors (NR). Recruited to promoters through its contact with the N-terminal basic helix-loop-helix-Per-Arnt-Sim (PAS) domain of transcription factors or coactivators, such as NCOA2. During ER-activation acts synergistically in combination with other NCOA2-binding proteins, such as EP300, CREBBP and CARM1. Involved in the transcriptional activation of target genes in the Wnt/CTNNB1 pathway. Functions as a secondary coactivator in LEF1-mediated transcriptional activation via its interaction with CTNNB1. Coactivator function for nuclear receptors and LEF1/CTNNB1 involves differential utilization of two different activation regions. In association with CCAR1 enhances GATA1- and MED1-mediated transcriptional activation from the gamma-globin promoter during erythroid differentiation of K562 erythroleukemia cells (PubMed:24245781).[UniProtKB/Swiss-Prot Function]