Ecd (NM_027475) Mouse Recombinant Protein

CAT#: TP509694

Purified recombinant protein of Mouse ecdysoneless cell cycle regulator (Ecd), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR209694 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEGSGKLAMVEDAVEYHLFLIPDKARGTEEHREILQKYIERIMTQFAPILVPYIWQNQPFNLKYKPAKGG
  VPAHMYGMTKFGDNIEDEWFIVYVIKQITKEFPELVARVEDNDGEFLLIEAADFLPKWLDPDNSANRVFF
  HHGELCIIPVPRKSERIPWLPMTPPTIQQALSIISAHPEAVLASESIQAAVDRRVSGYPERVEASLHRAH
  CFLPAGIVAVLKQQPRLLSAAVQAFYLRDPIDLRACRVFKTFLPETRIMASVTFTKCLYAQLVQQKFVPD
  RRSGYGLPPPSHPQYRAYELGMKLAHGFEILCSKCSPHFSDSRKSLVTASPLWASFLESLKRNDYFKGLM
  DGSAQYQERLEMAKNYFQLSIHRPESSLAMSPGEEILTVLQTQPFDVAELKTEEADLPPEDDDQWLDLSP
  DQLDQLLQDAAGRKESQPGPQKEELQNYDVAQVSDSMKAFISKVSSHKGAELPRDPSEAPITFDADSFLN
  YFDKILGAKPQESDSEDDPGEEDVEGVDSDDDVGFEAQESESLKGALGSLKSYMARMDQELAHTSMGRSF
  TTRERLNKDPPSHTANDNSDEEDSGAGDCAVEAVDVDLNLISNILESYSSQAGLAGPASNLLHSMGVRLP
  DNADHNPQVSQ
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 71.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_081751
• Locus ID: 70601
• UniProt ID: Q9CS74
• Cytogenetics: 14 A3
• Refseq Size: 3125
• Refseq ORF: 1926
• Synonyms: 5730461K03Rik; Hsgt1
• Summary: Regulator of p53/TP53 stability and function. Inhibits MDM2-mediated degradation of p53/TP53 possibly by cooperating in part with TXNIP. May be involved transcriptional regulation. In vitro has intrinsic transactivation activity enhanced by EP300. May be a transcriptional activator required for the expression of glycolytic genes (By similarity). Involved in regulation of cell cycle progression (PubMed:26711270). Proposed to disrupt Rb-E2F binding leading to transcriptional activation of E2F proteins (PubMed:19640839). The cell cycle -regulating function may depend on its RUVBL1-mediated association with the R2TP complex. May play a role in regulation of pre-mRNA splicing (By similarity).[UniProtKB/Swiss-Prot Function]