Dbr1 (BC006661) Mouse Recombinant Protein

CAT#: TP508704

Purified recombinant protein of Mouse cDNA clone MGC:6384 IMAGE:3501390, complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR208704 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRVAVAGCCHGELDKIYETLALAERRGSGPVDLLLCCGDFQAVRNEADLRCMAVPPKYRHMQTFYRYYSG
  EKKAPVLTIFIGGNHEASNHLQELPYGGWVAPNIYYLGLAGVVKYRGVRIGGISGIFKSHDYRKGHFECP
  PYNSSTIRSIYHVRNIEVYKLKQLKQPVHIFLSHDWPRNIYHYGNKKQLLKTKSFFRQEVENSTLGSPAA
  SELLEHLQPAYWFSAHLHVKFAALMQHQATDKGRAGKETKFLALDKCLPHRDFLQVLEIEHDPSAPEYLE
  YDVEWLTVLRATDDLINVTGGLWNMPEDNGLHTRWDYSATEETMKEVMEKLNHDPKVPCNFTMTAACYDP
  SKPQTQVKLVHRINPQTTEFCAQLGITDINVMIQKAREEEHHQCGEYEQQGDPGTEESEEDRSEYNTDTS
  ALSSINPDEIMLDEEEEEEEEAVSAHSDMNTPSVEPASDQASDLSTSFSDVRNLPSSMFVSSDDASRSPA
  SGEGKCGETVESGDEKDLAKFPLKRLSDEHEPEQRKKIKRRNQAIYAAVDDGDASAE
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 61.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• Locus ID: 83703
• UniProt ID: Q923B1
• Cytogenetics: 9 E3.3
• Refseq Size: 2221
• Refseq ORF: 1641
• Synonyms: AW018415
• Summary: Cleaves the 2'-5' phosphodiester linkage at the branch point of lariat intron pre-mRNAs after splicing and converts them into linear molecules that are subsequently degraded. It thereby facilitates ribonucleotide turnover. It may also participate in retrovirus replication via an RNA lariat intermediate in cDNA synthesis (By similarity).[UniProtKB/Swiss-Prot Function]