Nae1 (NM_144931) Mouse Recombinant Protein

CAT#: TP508551

Purified recombinant protein of Mouse NEDD8 activating enzyme E1 subunit 1 (Nae1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR208551 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAQPGKILKEQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNLVSGEDA
  GNNFFLQKSSIGKNRAQAAMEFLQELNSDVSGSFVEESPENLLDNDPSFFCRFTIVVATQLLESTLLRLA
  DVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPDNALEDLRLDKPFPELREHLQSYDLDHMEKKDHS
  HTPWIVIIAKYLAQWYNETNGRIPKSYKEKEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQ
  IPSSIEDIFNDDRCINITKQTPTFWILARALKEFVAKEGQGNLPVRGTIPDMIADSNKYIKLQNVYREKA
  KKDAAAVGNHVAKLLQSVGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTVNKDEIISSMDNPD
  NEIVLYLMLRAVDRFHKQHGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVMVKDDYVHEFCRYGAAEP
  HTIAAFLGGAAAQEVIKIITKQFVIFNNTYIYSGMSQTSATFQL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 60.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_659180
• Locus ID: 234664
• UniProt ID: Q8VBW6, Q3UK27
• Cytogenetics: 8 D3
• Refseq Size: 1808
• Refseq ORF: 1605
• Synonyms: 59kDa; Appbp1
• Summary: Regulatory subunit of the dimeric UBA3-NAE1 E1 enzyme. E1 activates NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-UBA3 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of UBE2M. Necessary for cell cycle progression through the S-M checkpoint. Overexpression of NAE1 causes apoptosis through deregulation of NEDD8 conjugation (By similarity).[UniProtKB/Swiss-Prot Function]