Ric8a (NM_053194) Mouse Recombinant Protein

CAT#: TP508493

Purified recombinant protein of Mouse RIC8 guanine nucleotide exchange factor A (Ric8a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR208493 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEPRAVADALETGEEDAVTEALRSFNREHSQSFTFDDAQQEDRKRLAKLLVSVLEQGLSPKHRVTWLQTI
  RILSRDRSCLDSFASRQSLHALACYADITVSEEPIPQSPDMDVLLESLKCLCNLVLSSPTAQMLAAEARL
  VVRLAERVGLYRKRSYPHEVQFFDLRLLFLLTALRTDVRQQLFQELHGVRLLTDALELTLGVAPKENPPV
  MLPAQETERAMEILKVLFNITFDSVKREVDEEDAALYRYLGTLLRHCVMVEAAGDRTEEFHGHTVNLLGN
  LPLKCLDVLLALELHEGSLEFMGVNMDVISALLAFLEKRLHQTHRLKECVAPVLNVLTECARMHRPARKF
  LKAQVLPPLRDVRTRPEVGDLLRNKLVRLMTHLDTDVKRVAAEFLFVLCSESVPRFIKYTGYGNAAGLLA
  ARGLMAGGRPEGQYSEDEDTDTEEYREAKASINPVTGRVEEKPPNPMEGMTEEQKEHEAMKLVNMFDKLS
  RHRVIQPMGMSPRGHLTSLQDAMCETMEGQLSSDPDSDPD
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 59.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_444424
• Locus ID: 101489
• UniProt ID: Q3TIR3
• Cytogenetics: 7 F4
• Refseq Size: 2967
• Refseq ORF: 1593
• Synonyms: AI114950; RIC-8; Ric8
• Summary: Guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins. Able to activate GNAI1, GNAO1 and GNAQ, but not GNAS by exchanging bound GDP for free GTP. Involved in regulation of microtubule pulling forces during mitotic movement of chromosomes by stimulating G(i)-alpha protein, possibly leading to release G(i)-alpha-GTP and NuMA proteins from the NuMA-GPSM2-G(i)-alpha-GDP complex. Also acts as an activator for G(q)-alpha (GNAQ) protein by enhancing the G(q)-coupled receptor-mediated ERK activation (By similarity).[UniProtKB/Swiss-Prot Function]